Structure of PDB 1urn Chain A Binding Site BS01

Receptor Information
>1urn Chain A (length=96) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKM
RGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKM
Ligand information
>1urn Chain P (length=20) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aauccauugcacucggauuu
.<<<<.........>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1urn Crystal structure at 1.92 A resolution of the RNA-binding domain of the U1A spliceosomal protein complexed with an RNA hairpin.
Resolution1.92 Å
Binding residue
(original residue number in PDB)		Y13 N15 N16 E19 K22 L49 K50 M51 R52 Q54 F56 K80 Q85 A87 K88 T89 D90 S91 D92
Binding residue
(residue number reindexed from 1)		Y12 N14 N15 E18 K21 L48 K49 M50 R51 Q53 F55 K79 Q84 A86 K87 T88 D89 S90 D91
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:1urn, PDBe:1urn, PDBj:1urn
PDBsum1urn
PubMed7984237
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]