Structure of PDB 1uj0 Chain A Binding Site BS01

Receptor Information
>1uj0 Chain A (length=58) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MARRVRALYDFEAVEDNELTFKHGELITVLDDSDANWWQGENHRGTGLFP
SNFVTTDL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1uj0 Structural insight into modest binding of a non-PXXP ligand to the signal transducing adaptor molecule-2 Src homology 3 domain.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		Y211 F213 V216 E217 N219 E220 N238 W239 F255
Binding residue
(residue number reindexed from 1)		Y9 F11 V14 E15 N17 E18 N36 W37 F53
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1uj0, PDBe:1uj0, PDBj:1uj0
PDBsum1uj0
PubMed13129930
UniProtO88811|STAM2_MOUSE Signal transducing adapter molecule 2 (Gene Name=Stam2)

[Back to BioLiP]