Structure of PDB 1uhl Chain A Binding Site BS01

Receptor Information

>1uhl Chain A (length=214) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EMPVDRILEAELAVEQSPNDPVTNICQAADKQLFTLVEWAKRIPHFSSLP
LDDQVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVG
AIFDRVLTELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLR
EKVYASLETYCKQKYPEQQGRFAKLLLRLPALRSIGLKCLEHLFFFKLIG
DTPIDTFLMEMLEA

Ligand information

>1uhl Chain C (length=9) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

HKILHRLLQ

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1uhl Crystal structure of the heterodimeric complex of LXRalpha and RXRbeta ligand-binding domains in a fully agonistic conformation
Resolution	2.9 Å
Binding residue (original residue number in PDB)	V351 K355 V369 L372 E524
Binding residue (residue number reindexed from 1)	V37 K41 V55 L58 E210

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003707	nuclear steroid receptor activity
GO:0008270	zinc ion binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1uhl, PDBe:1uhl, PDBj:1uhl
PDBsum	1uhl
PubMed	12970175
UniProt	P28702\|RXRB_HUMAN Retinoic acid receptor RXR-beta (Gene Name=RXRB)

[Back to BioLiP]