Structure of PDB 1uhd Chain A Binding Site BS01

Receptor Information
>1uhd Chain A (length=96) Species: 210 (Helicobacter pylori) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SITIDEDLAKLAKLREGMKVEIVDVNNGERFSTYVILGKKRGEICVNGAA
ARKVAIGDVVIILAYASMNEDEINAHKPSIVLVDEKNEILEKGLEH
Ligand information
>1uhd Chain B (length=24) Species: 210 (Helicobacter pylori) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MTFEMLYSKIHRATITDANLNYIG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1uhd Crystal structure of the schiff base intermediate prior to decarboxylation in the catalytic cycle of aspartate alpha-decarboxylase
Resolution2.0 Å
Binding residue
(original residue number in PDB)		A36 K37 L38 I68 C69 V70 N71 G72 A75 R76 I80 G81 D82 V83 V84 I85 I86 L87 A88 Y89 A90 S91 M92 I97 H100 P102 S103 I104 V105 L106 N111
Binding residue
(residue number reindexed from 1)		A12 K13 L14 I44 C45 V46 N47 G48 A51 R52 I56 G57 D58 V59 V60 I61 I62 L63 A64 Y65 A66 S67 M68 I73 H76 P78 S79 I80 V81 L82 N87
Enzymatic activity
Enzyme Commision number 4.1.1.11: aspartate 1-decarboxylase.
Gene Ontology
Molecular Function
GO:0004068 aspartate 1-decarboxylase activity
Biological Process
GO:0006523 alanine biosynthetic process

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1uhd, PDBe:1uhd, PDBj:1uhd
PDBsum1uhd
PubMed15184017
UniProtP56065|PAND_HELPY Aspartate 1-decarboxylase (Gene Name=panD)

[Back to BioLiP]