Structure of PDB 1uef Chain A Binding Site BS01

Receptor Information
>1uef Chain A (length=105) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MGSQFWVTSQKTEASERCGLQGSYILRVEAEKLTLLTLGAQSQILEPLLF
WPYTLLRRYGRDKVMFSFEAGRRCPSGPGTFTFQTSQGNDIFQAVEAAIQ
QQKAQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1uef Structural Basis for the Specific Recognition of RET by the Dok1 Phosphotyrosine Binding Domain
Resolution2.5 Å
Binding residue
(original residue number in PDB)		T57 L58 L59 R60 R61 Y62 G63 R64 S70 R75 F95 I102
Binding residue
(residue number reindexed from 1)		T54 L55 L56 R57 R58 Y59 G60 R61 S67 R72 F92 I99
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1uef, PDBe:1uef, PDBj:1uef
PDBsum1uef
PubMed14607833
UniProtP97465|DOK1_MOUSE Docking protein 1 (Gene Name=Dok1)

[Back to BioLiP]