Structure of PDB 1u9l Chain A Binding Site BS01

Receptor Information
>1u9l Chain A (length=68) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AHAAIDTFTKYLDIDEDFATVLVEEGFSTLEELAYVPMKELLEIEGLDEP
TVEALRERAKNALATIAQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1u9l Structural basis for the interaction of Escherichia coli NusA with protein N of phage lambda
Resolution1.9 Å
Binding residue
(original residue number in PDB)		D364 D366 F369 G397 L398 R409
Binding residue
(residue number reindexed from 1)		D13 D15 F18 G46 L47 R58
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000166 nucleotide binding

View graph for
Molecular Function
External links
PDB RCSB:1u9l, PDBe:1u9l, PDBj:1u9l
PDBsum1u9l
PubMed15365170
UniProtP0AFF6|NUSA_ECOLI Transcription termination/antitermination protein NusA (Gene Name=nusA)

[Back to BioLiP]