Structure of PDB 1u8b Chain A Binding Site BS01

Receptor Information
>1u8b Chain A (length=132) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKDDQRWQSVLARDPNADGEFVFAVRTTGIFCRPSCRARHALRENVSFYA
NASEALAAGFRPCKRCQPDKANPRQHRLDKITHACRLLEQETPVTLEALA
DQVAMSPFHLHRLFKATTGMTPKAWQQAWRAR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1u8b A methylation-dependent electrostatic switch controls DNA repair and transcriptional activation by E. coli ada.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		V31 T33 T34 I36 R45 A47 L48 N51 R67 K70
Binding residue
(residue number reindexed from 1)		V25 T27 T28 I30 R39 A41 L42 N45 R61 K64
Enzymatic activity
Enzyme Commision number 2.1.1.63: methylated-DNA--[protein]-cysteine S-methyltransferase.
2.1.1.n11: methylphosphotriester-DNA--[protein]-cysteine S-methyltransferase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0008168 methyltransferase activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006281 DNA repair
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1u8b, PDBe:1u8b, PDBj:1u8b
PDBsum1u8b
PubMed16209950
UniProtP06134|ADA_ECOLI Bifunctional transcriptional activator/DNA repair enzyme Ada (Gene Name=ada)

[Back to BioLiP]