Structure of PDB 1u6h Chain A Binding Site BS01

Receptor Information
>1u6h Chain A (length=252) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVSAVQAA
VSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPY
SVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEV
VETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKE
LLPVLISAMKIFVTTKNTKSQGIEEALKNRNFTVEKMSAEINEIIRVLQL
TS
Ligand information
>1u6h Chain B (length=24) Species: 9031 (Gallus gallus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SRKLLSAAKILADATAKMVEAAKG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1u6h A vinculin binding domain from the talin rod unfolds to form a complex with the vinculin head.
Resolution2.38 Å
Binding residue
(original residue number in PDB)		V15 Q18 H21 M25 I36 P42 V46 A49 L53 R55 V56 L122 F125
Binding residue
(residue number reindexed from 1)		V16 Q19 H22 M26 I37 P43 V47 A50 L54 R56 V57 L123 F126
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003779 actin binding
GO:0005198 structural molecule activity
GO:0051015 actin filament binding
Biological Process
GO:0007155 cell adhesion
Cellular Component
GO:0015629 actin cytoskeleton

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1u6h, PDBe:1u6h, PDBj:1u6h
PDBsum1u6h
PubMed15642262
UniProtP12003|VINC_CHICK Vinculin (Gene Name=VCL)

[Back to BioLiP]