Structure of PDB 1u63 Chain A Binding Site BS01

Receptor Information
>1u63 Chain A (length=214) Species: 2190 (Methanocaldococcus jannaschii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDREALLQAVKEARELAKPRNFTQSFEFIATLKEIDMRKPENRIKTEVVL
PHGRGKEAKIAVIGTGDLAKQAEELGLTVIRKEEIEELGKNKRKLRKIAK
AHDFFIAQADLMPLIGRYMGVILGPRGKMPKPVPANANIKPLVERLKKTV
VINTRDKPYFQVLVGNEKMTDEQIVDNIEAVLNVVAKKYEKGLYHIKDAY
VKLTMGPAVKVKKE
Ligand information
>1u63 Chain B (length=49) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gggagugaaggaggcucgcgaacucgcgaagccgagaaacuucacuccc
.<<<<<<<<<..<<<<<<<<....>>>>.>>>>......>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1u63 Ribosomal protein L1 recognizes the same specific structural motif in its target sites on the autoregulatory mRNA and 23S rRNA.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		K18 R20 N21 S25 I29 T31 R96 K100 Y159 Q161 Y200 T204 M205 G206 A208
Binding residue
(residue number reindexed from 1)		K18 R20 N21 S25 I29 T31 R96 K100 Y159 Q161 Y200 T204 M205 G206 A208
Binding affinityPDBbind-CN: Kd=0.52nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
GO:0006417 regulation of translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1u63, PDBe:1u63, PDBj:1u63
PDBsum1u63
PubMed15659579
UniProtP54050|RL1_METJA Large ribosomal subunit protein uL1 (Gene Name=rpl1)

[Back to BioLiP]