Structure of PDB 1u3s Chain A Binding Site BS01

Receptor Information
>1u3s Chain A (length=227) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISW
AKKIPGFVELSLFDQVRLLESCWMEVLMMGLMWRSIDHPGKLIFAPDLVL
DRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMYA
DSSRKLAHLLNAVTDALVWVIAKSGISSQQQSMRLANLLMLLSHVRHASN
KGMEHLLNMKCKNVVPVYDLLLEMLNA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1u3s Design and synthesis of aryl diphenolic azoles as potent and selective estrogen receptor-beta ligands.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		I310 K314 V328 D489 E493
Binding residue
(residue number reindexed from 1)		I48 K52 V66 D219 E223
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004879 nuclear receptor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1u3s, PDBe:1u3s, PDBj:1u3s
PDBsum1u3s
PubMed15456246
UniProtQ92731|ESR2_HUMAN Estrogen receptor beta (Gene Name=ESR2)

[Back to BioLiP]