Structure of PDB 1u3h Chain A Binding Site BS01

Receptor Information

>1u3h Chain A (length=110) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QVRQSPQSLTVWEGETAILNCSYENSAFDYFPWYQQFPGEGPALLISILS
VSDKKEDGRFTIFFNKREKKLSLHIADSQPGDSATYFCAASANSGTYQRF
GTGTKLQVVP

Ligand information

>1u3h Chain P (length=12) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

SRGGASQYRPSQ

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1u3h Structure of an autoimmune T cell receptor complexed with class II peptide-MHC: insights into MHC bias and antigen specificity
Resolution	2.42 Å
Binding residue (original residue number in PDB)	N99 G101
Binding residue (residue number reindexed from 1)	N93 G95

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Cellular Component
GO:0042101	T cell receptor complex

View graph for
Cellular Component

External links

PDB	RCSB:1u3h, PDBe:1u3h, PDBj:1u3h
PDBsum	1u3h
PubMed	15664161
UniProt	Q5R1B3

[Back to BioLiP]