Structure of PDB 1u1o Chain A Binding Site BS01

Receptor Information
>1u1o Chain A (length=183) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGF
GFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKI
FVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHD
SVDKIVIQKYHTVNGHNCEVRKALSKQEMASAS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1u1o Human UP1 as a Model for Understanding Purine Recognition in the Family of Proteins Containing the RNA Recognition Motif (RRM).
Resolution2.0 Å
Binding residue
(original residue number in PDB)
Q12 K15 F17 G19 G20 D42 V44 M46 R55 F57 F59 E85 A89 V90 R92 H101
Binding residue
(residue number reindexed from 1)
Q5 K8 F10 G12 G13 D35 V37 M39 R48 F50 F52 E78 A82 V83 R85 H94
Binding affinityPDBbind-CN: Kd=59nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:1u1o, PDBe:1u1o, PDBj:1u1o
PDBsum1u1o
PubMed15342234
UniProtP09651|ROA1_HUMAN Heterogeneous nuclear ribonucleoprotein A1 (Gene Name=HNRNPA1)

[Back to BioLiP]