Structure of PDB 1u0c Chain A Binding Site BS01

Receptor Information
>1u0c Chain A (length=152) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NTKYNKEFLLYLAGFVDGDGSIIAQIKPNQSCKFKHQLSLTFQVTEKTQR
RWFLDKLVDEIGVGYVRDRGSVSDYILSEIKPLHNFLTQLQPFLKLKQKQ
ANLVLKIIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAV
LD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1u0c Isolation and characterization of new homing endonuclease specificities at individual target site positions.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		G19 D20 G21 S22 I24 Q26 Q44 T46 E47 K48 R51 R70 N136 D137 S138 R141 K142
Binding residue
(residue number reindexed from 1)		G18 D19 G20 S21 I23 Q25 Q43 T45 E46 K47 R50 R69 N135 D136 S137 R140 K141
Binding affinityPDBbind-CN: Kd=25nM
Enzymatic activity
Catalytic site (original residue number in PDB) G19 D20
Catalytic site (residue number reindexed from 1) G18 D19
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006314 intron homing
Cellular Component
GO:0009507 chloroplast

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1u0c, PDBe:1u0c, PDBj:1u0c
PDBsum1u0c
PubMed15313605
UniProtP05725|DNE1_CHLRE DNA endonuclease I-CreI

[Back to BioLiP]