Structure of PDB 1u00 Chain A Binding Site BS01

Receptor Information
>1u00 Chain A (length=227) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDVIPLSLGLETMGGLVEKVIPRNTTIPVARAQDFTTFKDGQTAMSIHVM
QGERELVQDCRSLARFALRGIPALPAGGAHIRVTFQVDADGLLSVTAMEK
STGVEASIQVKPSYGLTDSEIASMIKDSMSYAEQDVKARMLAEQKVEAAR
VLESLHGALAADAALLSAAERQVIDDAAAHLSEVAQGDDVDAIEQAIKNV
DKQTQDFAARRMDQSVRRALKGHSVDE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1u00 Crystal Structure of the Molecular Chaperone HscA Substrate Binding Domain Complexed with the IscU Recognition Peptide ELPPVKIHC.
Resolution1.95 Å
Binding residue
(original residue number in PDB)		E399 T400 M401 E406 D422 F423 T424 F426 A432 M433 S434 H468
Binding residue
(residue number reindexed from 1)		E11 T12 M13 E18 D34 F35 T36 F38 A44 M45 S46 H80
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005524 ATP binding
GO:0140662 ATP-dependent protein folding chaperone

View graph for
Molecular Function
External links
PDB RCSB:1u00, PDBe:1u00, PDBj:1u00
PDBsum1u00
PubMed15351650
UniProtP0A6Z1|HSCA_ECOLI Chaperone protein HscA (Gene Name=hscA)

[Back to BioLiP]