Structure of PDB 1tx3 Chain A Binding Site BS01

Receptor Information
>1tx3 Chain A (length=249) Species: 727 (Haemophilus influenzae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SFIKPIYQDINSILIGQKVKRPAAGEPFEKLVYKFLKENLSDLTFKQYEY
LNDLFMKNPAIIGHEARYKLFNSPTLLFLLSRGKAATENWSIENLFEEKQ
NDTADILLVKDQFYELLDVKTRNISKSAQAPNIISAYKLAQTCAKMIDNK
EFDLFDINYLEVDWELNGEDLVCVSTSFAELFKSEPSELYINWAAAMQIQ
FHVRDLDQGFNGTREEWAKSYLKHFVTQAEQRAISMIDKFVKPFKKYIL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1tx3 Ca2+ binding in the active site of HincII: implications for the catalytic mechanism
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Y77 S90 K93 Q109 Q138 Y199 N201 A204 K248
Binding residue
(residue number reindexed from 1)		Y68 S81 K84 Q100 Q129 Y190 N192 A195 K239
Enzymatic activity
Enzyme Commision number 3.1.21.4: type II site-specific deoxyribonuclease.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0009036 type II site-specific deoxyribonuclease activity
Biological Process
GO:0009307 DNA restriction-modification system

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1tx3, PDBe:1tx3, PDBj:1tx3
PDBsum1tx3
PubMed15491133
UniProtP17743|T2C2_HAEIF Type II restriction enzyme HincII (Gene Name=hincIIR)

[Back to BioLiP]