Structure of PDB 1twq Chain A Binding Site BS01

Receptor Information
>1twq Chain A (length=165) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VCPNIIKRSAWEARETHCPKMNLPAKYVIIIHTAGTSCTVSTDCQTVVRN
IQSFHMDTRNFCDIGYHFLVGQDGGVYEGVGWHIQGSHTYGFNDIALGIA
FIGYFVEKPPNAAALEAAQDLIQCAVVEGYLTPNYLLMGHSDVVNILSPG
QALYNIISTWPHFKH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1twq Structural basis for peptidoglycan binding by peptidoglycan recognition proteins
Resolution2.3 Å
Binding residue
(original residue number in PDB)		T209 H231 R235 F237 Y242 S263 H264 T265 Y266 N269 H316
Binding residue
(residue number reindexed from 1)		T33 H55 R59 F61 Y66 S87 H88 T89 Y90 N93 H140
Enzymatic activity
Catalytic site (original residue number in PDB) Y242
Catalytic site (residue number reindexed from 1) Y66
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding
GO:0008745 N-acetylmuramoyl-L-alanine amidase activity
GO:0042834 peptidoglycan binding
Biological Process
GO:0009253 peptidoglycan catabolic process
GO:0045087 innate immune response

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1twq, PDBe:1twq, PDBj:1twq
PDBsum1twq
PubMed15572450
UniProtQ96LB9|PGRP3_HUMAN Peptidoglycan recognition protein 3 (Gene Name=PGLYRP3)

[Back to BioLiP]