Structure of PDB 1twb Chain A Binding Site BS01

Receptor Information
>1twb Chain A (length=106) Species: 727 (Haemophilus influenzae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSPKRPYLLRAYYDWLVDNSFTPYLVVDATYLGVNVPVECVKDGQIVLNL
SASATGNLQLTNDFIQFNARFKGVSRELYIPMGAALAIYARENGDGVMFE
PEEIYD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1twb Nucleotide-Dependent Substrate Handoff from the SspB Adaptor to the AAA+ ClpXP Protease.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		Y28 C44 V51 N53 S57 A58 T59 G60 N72 A73 R74 F75 K76 G77 S79 R95
Binding residue
(residue number reindexed from 1)		Y24 C40 V47 N49 S53 A54 T55 G56 N68 A69 R70 F71 K72 G73 S75 R91
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1twb, PDBe:1twb, PDBj:1twb
PDBsum1twb
PubMed15525508
UniProtP45206|SSPB_HAEIN Stringent starvation protein B homolog (Gene Name=sspB)

[Back to BioLiP]