Structure of PDB 1tp5 Chain A Binding Site BS01

Receptor Information
>1tp5 Chain A (length=115) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLS
GELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRF
EANSRVDSSGRIVTD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1tp5 Structure of the third PDZ domain of PSD-95 protein complexed with KKETWV peptide ligand
Resolution1.54 Å
Binding residue
(original residue number in PDB)		G322 L323 G324 F325 N326 I327 V328 S339 F340 H372
Binding residue
(residue number reindexed from 1)		G22 L23 G24 F25 N26 I27 V28 S39 F40 H72
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1tp5, PDBe:1tp5, PDBj:1tp5
PDBsum1tp5
PubMed
UniProtP31016|DLG4_RAT Disks large homolog 4 (Gene Name=Dlg4)

[Back to BioLiP]