Structure of PDB 1tp3 Chain A Binding Site BS01

Receptor Information
>1tp3 Chain A (length=115) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLS
GELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRF
EANSRVDSSGRIVTD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1tp3 Structure of the third PDZ domain of PSD-95 protein complexed with KKETPV peptide ligand
Resolution1.99 Å
Binding residue
(original residue number in PDB)
L323 G324 F325 N326 I327 V328 S339 H372 K380
Binding residue
(residue number reindexed from 1)
L23 G24 F25 N26 I27 V28 S39 H72 K80
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1tp3, PDBe:1tp3, PDBj:1tp3
PDBsum1tp3
PubMed
UniProtP31016|DLG4_RAT Disks large homolog 4 (Gene Name=Dlg4)

[Back to BioLiP]