Structure of PDB 1tn9 Chain A Binding Site BS01

Receptor Information
>1tn9 Chain A (length=69) Species: 1351 (Enterococcus faecalis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPA
GKRDAISLREKIAELQKDI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1tn9 NMR structure of the Tn916 integrase-DNA complex.
ResolutionN/A
Binding residue
(original residue number in PDB)		T15 G16 E17 S18 R20 K21 K28 I30 R55
Binding residue
(residue number reindexed from 1)		T13 G14 E15 S16 R18 K19 K26 I28 R53
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0008907 integrase activity
Biological Process
GO:0015074 DNA integration

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1tn9, PDBe:1tn9, PDBj:1tn9
PDBsum1tn9
PubMed10201406
UniProtP22886|TNR6_ENTFL Transposase from transposon Tn916 (Gene Name=Int-Tn)

[Back to BioLiP]