Structure of PDB 1tj9 Chain A Binding Site BS01

Receptor Information

>1tj9 Chain A (length=121) Species: 31159 (Daboia russelii russelii)

SLLEFGKMILEETGKLAIPSYSSYGCYCGWGGKGTPKDATDRCCFVHDCC
YGNLPDCNPKSDRYKYKRVNGAIVCEKGTSCENRICECDKAAAICFRQNL
NTYSKKYMLYPDFLCKGELKC

Ligand information

>1tj9 Chain B (length=4)

VARS

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1tj9 Structure of the complex formed between group II phospholipase A2 and a rationally designed tetra peptide,Val-Ala-Arg-Ser at 1.1A resolution
• Resolution: 1.1 Å
• Binding residue (original residue number in PDB): H48 D49 Y52 G53 C61 N67 P68
• Binding residue (residue number reindexed from 1): H47 D48 Y51 G52 C57 N58 P59

Enzymatic activity

• Catalytic site (original residue number in PDB): Y28 G30 G32 H48 D49 Y52 Y73 D99
• Catalytic site (residue number reindexed from 1): Y27 G29 G31 H47 D48 Y51 Y64 D89
• Enzyme Commision number: 3.1.1.4: phospholipase A2.

Gene Ontology

Molecular Function

• GO:0004623 phospholipase A2 activity
• GO:0005509 calcium ion binding
• GO:0005543 phospholipid binding
• GO:0016787 hydrolase activity
• GO:0046872 metal ion binding
• GO:0047498 calcium-dependent phospholipase A2 activity
• GO:0090729 toxin activity

Biological Process

• GO:0006644 phospholipid metabolic process
• GO:0016042 lipid catabolic process
• GO:0035821 modulation of process of another organism
• GO:0042130 negative regulation of T cell proliferation
• GO:0050482 arachidonate secretion

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:1tj9, PDBe:1tj9, PDBj:1tj9
• PDBsum: 1tj9
• UniProt: P59071|PA2B8_DABRR Basic phospholipase A2 VRV-PL-VIIIa