Structure of PDB 1tgh Chain A Binding Site BS01

Receptor Information
>1tgh Chain A (length=180) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPR
TTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNM
VGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSG
KVVLTGAKVRAEIYEAFENIYPILKGFRKT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1tgh How proteins recognize the TATA box.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		V165 F193 F210 K214 V216 Q252 N253 L283 F284 I288 R290 V297 L299 T309 G310
Binding residue
(residue number reindexed from 1)		V11 F39 F56 K60 V62 Q98 N99 L129 F130 I134 R136 V143 L145 T155 G156
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006352 DNA-templated transcription initiation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1tgh, PDBe:1tgh, PDBj:1tgh
PDBsum1tgh
PubMed8757291
UniProtP20226|TBP_HUMAN TATA-box-binding protein (Gene Name=TBP)

[Back to BioLiP]