Structure of PDB 1tf6 Chain A Binding Site BS01

Receptor Information
>1tf6 Chain A (length=179) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YKRYICSFADCGAAYNKNWKLQAHLCKHTGEKPFPCKEEGCEKGFTSLHH
LTRHSLTHTGEKNFTCDSDGCDLRFTTKANMKKHFNRFHNIKICVYVCHF
ENCGKAFKKHNQLKVHQFSHTQQLPYECPHEGCDKRFSLPSRLKRHEKVH
AGYPCKKDDSCSFVGKTWTLYLKHVAECH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1tf6 Differing roles for zinc fingers in DNA recognition: structure of a six-finger transcription factor IIIA complex.
Resolution3.1 Å
Binding residue
(original residue number in PDB)
Y24 W28 K29 K36 F54 H59 R62 F84 T85 N89 K92 R96 R151 R154 H155
Binding residue
(residue number reindexed from 1)
Y15 W19 K20 K27 F45 H50 R53 F75 T76 N80 K83 R87 R142 R145 H146
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1tf6, PDBe:1tf6, PDBj:1tf6
PDBsum1tf6
PubMed9501194
UniProtP03001|TF3A_XENLA Transcription factor IIIA (Gene Name=gtf3a)

[Back to BioLiP]