Structure of PDB 1tf3 Chain A Binding Site BS01

Receptor Information
>1tf3 Chain A (length=92) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKRYICSFADCGAAYNKNWKLQAHLSKHTGEKPFPCKEEGCEKGFTSLHH
LTRHSLTHTGEKNFTCDSDGCDLRFTTKANMKKHFNRFHNIK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1tf3 Domain packing and dynamics in the DNA complex of the N-terminal zinc fingers of TFIIIA.
ResolutionN/A
Binding residue
(original residue number in PDB)		W28 K29 A32 S35 K36 G53 F54 T55 H59 R62 H63 T66 K71 F84 T85 N89 K92 H93 R96 F97
Binding residue
(residue number reindexed from 1)		W19 K20 A23 S26 K27 G44 F45 T46 H50 R53 H54 T57 K62 F75 T76 N80 K83 H84 R87 F88
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1tf3, PDBe:1tf3, PDBj:1tf3
PDBsum1tf3
PubMed9253405
UniProtP03001|TF3A_XENLA Transcription factor IIIA (Gene Name=gtf3a)

[Back to BioLiP]