Structure of PDB 1t9i Chain A Binding Site BS01

Receptor Information
>1t9i Chain A (length=153) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NTKYNKEFLLYLAGFVDGNGSIIAQIKPNQSYKFKHQLSLTFQVTQKTQR
RWFLDKLVDEIGVGYVRDRGSVSDYILSEIKPLHNFLTQLQPFLKLKQKQ
ANLVLKIIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAV
LDS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1t9i Metal-Dependent DNA Cleavage Mechanism of the I-CreI LAGLIDADG Homing Endonuclease.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		N20 S22 Q26 N30 Q44 T46 Q47 K48 R51 R70 V73 N136 D137 S138 R141 K142
Binding residue
(residue number reindexed from 1)		N19 S21 Q25 N29 Q43 T45 Q46 K47 R50 R69 V72 N135 D136 S137 R140 K141
Binding affinityPDBbind-CN: Kd=1.8nM
Enzymatic activity
Catalytic site (original residue number in PDB) G19 N20
Catalytic site (residue number reindexed from 1) G18 N19
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006314 intron homing
Cellular Component
GO:0009507 chloroplast

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1t9i, PDBe:1t9i, PDBj:1t9i
PDBsum1t9i
PubMed15518550
UniProtP05725|DNE1_CHLRE DNA endonuclease I-CreI

[Back to BioLiP]