Structure of PDB 1t7d Chain A Binding Site BS01

Receptor Information
>1t7d Chain A (length=208) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IYEPFQIPSGSMMPTLLIGDFILVEKFHPKRGDIVVFKYPEDPKLDYIKR
AVGLPGDKVTYDPVSKELTIQPGCNALPVTYSNVEPSDFVQTFSRREATS
GFFEVPKNETKENGIRLSERKETLGDVTHRILTVPIAQDQVGMYYQQPGQ
QLATWIVPPGQYFMMGDNRDNSADSRYWGFVPEANLVGRATAIWMSFDLR
LSRIGGIH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1t7d Crystallographic and Biophysical Analysis of a Bacterial Signal Peptidase in Complex with a Lipopeptide Based Inhibitor.
Resolution2.47 Å
Binding residue
(original residue number in PDB)		E82 P83 Q85 P87 D142 Y143 I144 K145
Binding residue
(residue number reindexed from 1)		E3 P4 Q6 P8 D46 Y47 I48 K49
Enzymatic activity
Catalytic site (original residue number in PDB) S88 S90 K145 S278
Catalytic site (residue number reindexed from 1) S9 S11 K49 S172
Enzyme Commision number 3.4.21.89: signal peptidase I.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
GO:0008236 serine-type peptidase activity
Biological Process
GO:0006465 signal peptide processing
GO:0006508 proteolysis
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1t7d, PDBe:1t7d, PDBj:1t7d
PDBsum1t7d
PubMed15136583
UniProtP00803|LEP_ECOLI Signal peptidase I (Gene Name=lepB)

[Back to BioLiP]