Structure of PDB 1t6o Chain A Binding Site BS01

Receptor Information
>1t6o Chain A (length=49) Species: 11234 (Measles morbillivirus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GASRSVIRSIIKSSRLEEDRKRYLMTLLDDIKGANDLAKFHQMLMKIIM
Ligand information
>1t6o Chain B (length=19) Species: 11234 (Measles morbillivirus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QDSRRSADALLRLQAMAGI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1t6o Structural basis for the attachment of a paramyxoviral polymerase to its template.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		Y480 L481 D487 I488 K489 D493 F497 M500 I504
Binding residue
(residue number reindexed from 1)		Y23 L24 D30 I31 K32 D36 F40 M43 I47
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003968 RNA-dependent RNA polymerase activity
Biological Process
GO:0006351 DNA-templated transcription
GO:0019079 viral genome replication

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1t6o, PDBe:1t6o, PDBj:1t6o
PDBsum1t6o
PubMed15159535
UniProtQ77M42|PHOSP_MEASM Phosphoprotein (Gene Name=P)

[Back to BioLiP]