Structure of PDB 1t39 Chain A Binding Site BS01

Receptor Information
>1t39 Chain A (length=151) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CEMKRTTLDSPLGKLELSGCEQGLHEIKLLGPEPLMQCTAWLNAYFHQPE
AIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNP
KAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGH
R
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1t39 DNA binding and nucleotide flipping by the human DNA repair protein AGT.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		Y114 Q115 R128 R135 C145 C150 S151 N157 Y158
Binding residue
(residue number reindexed from 1)		Y90 Q91 R104 R111 C121 C126 S127 N133 Y134
Enzymatic activity
Enzyme Commision number 2.1.1.63: methylated-DNA--[protein]-cysteine S-methyltransferase.
Gene Ontology
Molecular Function
GO:0003824 catalytic activity
GO:0003908 methylated-DNA-[protein]-cysteine S-methyltransferase activity
Biological Process
GO:0006281 DNA repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1t39, PDBe:1t39, PDBj:1t39
PDBsum1t39
PubMed15221026
UniProtP16455|MGMT_HUMAN Methylated-DNA--protein-cysteine methyltransferase (Gene Name=MGMT)

[Back to BioLiP]