Structure of PDB 1t2w Chain A Binding Site BS01

Receptor Information
>1t2w Chain A (length=145) Species: 1280 (Staphylococcus aureus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLD
DQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDV
KPTDVGVLDEQKGKDKQLTLITADDYNEKTGVWEKRKIFVATEVK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1t2w Crystal structure of Staphylococcus aureus sortase A and its substrate complex
Resolution1.8 Å
Binding residue
(original residue number in PDB)		A92 A104 E105 S116 Q172 I182 W194 R197
Binding residue
(residue number reindexed from 1)		A31 A43 E44 S55 Q111 I121 W133 R136
Enzymatic activity
Enzyme Commision number ?
External links