Structure of PDB 1t2t Chain A Binding Site BS01

Receptor Information
>1t2t Chain A (length=96) Species: 10665 (Tequatrovirus T4) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KFCKCGVRIQTSAYTCSKCRNRSGENNSFFNHKHSDITKSKISEKMKGKK
PSNIKKISCDGVIFDCAADAARHFKISSGLVTYRVKSDKWNWFYIN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1t2t Intron-encoded homing endonuclease I-TevI also functions as a transcriptional autorepressor.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		R170 G172 N175 F177 N179 H180 K181 H182 I190 S191 M194 K195 K197 K198 P199 N201 I202 K203 C214 A215 A216 R220 T230 Y242
Binding residue
(residue number reindexed from 1)		R22 G24 N27 F29 N31 H32 K33 H34 I42 S43 M46 K47 K49 K50 P51 N53 I54 K55 C66 A67 A68 R72 T82 Y94
Binding affinityPDBbind-CN: Kd=5.3nM
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004519 endonuclease activity

View graph for
Molecular Function
External links
PDB RCSB:1t2t, PDBe:1t2t, PDBj:1t2t
PDBsum1t2t
PubMed15361856
UniProtP13299|TEV1_BPT4 Intron-associated endonuclease 1 (Gene Name=ITEVIR)

[Back to BioLiP]