Structure of PDB 1t2k Chain A Binding Site BS01

Receptor Information
>1t2k Chain A (length=110) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFG
IFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHD
PHKIYEFVNS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1t2k Crystal structure of ATF-2/c-Jun and IRF-3 bound to the interferon-beta enhancer.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		W38 H40 G41 L42 P74 K77 R81 K105
Binding residue
(residue number reindexed from 1)		W36 H38 G39 L40 P72 K75 R79 K103
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1t2k, PDBe:1t2k, PDBj:1t2k
PDBsum1t2k
PubMed15510218
UniProtQ14653|IRF3_HUMAN Interferon regulatory factor 3 (Gene Name=IRF3)

[Back to BioLiP]