Structure of PDB 1t01 Chain A Binding Site BS01

Receptor Information
>1t01 Chain A (length=255) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AMPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVSAVQA
AVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADP
YSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAE
VVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVK
ELLPVLISAMKIFVTTKNTKSQGIEEALKNRNFTVEKMSAEINEIIRVLQ
LTSWD
Ligand information
>1t01 Chain B (length=24) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GRPLLQAAKGLAGAVSELLRSAQP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1t01 Activation of a vinculin-binding site in the talin rod involves rearrangement of a five-helix bundle
Resolution2.06 Å
Binding residue
(original residue number in PDB)		I12 V16 Q19 I20 M26 P43 V47 A50 L54 V57 I115 L122 F126
Binding residue
(residue number reindexed from 1)		I13 V17 Q20 I21 M27 P44 V48 A51 L55 V58 I116 L123 F127
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003779 actin binding
GO:0005198 structural molecule activity
GO:0051015 actin filament binding
Biological Process
GO:0007155 cell adhesion
Cellular Component
GO:0015629 actin cytoskeleton

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1t01, PDBe:1t01, PDBj:1t01
PDBsum1t01
PubMed15272303
UniProtP12003|VINC_CHICK Vinculin (Gene Name=VCL)

[Back to BioLiP]