Structure of PDB 1szd Chain A Binding Site BS01

Receptor Information

>1szd Chain A (length=291) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MASMSVSTASTEMSVRKIAAHMKSNPNAKVIFMVGAGISTSCGIPDFRSP
GTGLYHNLARLKLPYPEAVFDVDFFQSDPLPFYTLAKELYPGNFRPSKFH
YLLKLFQDKDVLKRVYTQNIDTLERQAGVKDDLIIEAHGSFAHCHCIGCG
KVYPPQVFKSKLAEHPIKDFVKCDVCGELVKPAIVFFGEDLPDSFSETWL
NDSEWLREKITTQQPLVIVVGTSLAVYPFASLPEEIPRKVKRVLCNLETV
GDFKANKRPTDLIVHQYSDEFAEQLVEELGWQEDFEKILTA

Ligand information

>1szd Chain B (length=8) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

KGGAKRHR

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1szd Structural basis for nicotinamide cleavage and ADP-ribose transfer by NAD(+)-dependent Sir2 histone/protein deacetylases.
Resolution	1.5 Å
Binding residue (original residue number in PDB)	E64 H135 V182 F184 G185 E186 D187 D190 S193 A227 V228 Y229 P230
Binding residue (residue number reindexed from 1)	E67 H138 V185 F187 G188 E189 D190 D193 S196 A225 V226 Y227 P228

Enzymatic activity

Catalytic site (original residue number in PDB)	P42 D43 F44 R45 N116 D118 H135
Catalytic site (residue number reindexed from 1)	P45 D46 F47 R48 N119 D121 H138
Enzyme Commision number	2.3.1.286: protein acetyllysine N-acetyltransferase.

Gene Ontology

	Molecular Function
GO:0017136	NAD-dependent histone deacetylase activity
GO:0051287	NAD binding
GO:0070403	NAD+ binding

View graph for
Molecular Function

External links

PDB	RCSB:1szd, PDBe:1szd, PDBj:1szd
PDBsum	1szd
PubMed	15150415
UniProt	P53686\|HST2_YEAST NAD-dependent protein deacetylase HST2 (Gene Name=HST2)

[Back to BioLiP]