Structure of PDB 1ssc Chain A Binding Site BS01

Receptor Information
>1ssc Chain A (length=112) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHES
LADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTT
QANKHIIVACEG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ssc 1.6 A structure of semisynthetic ribonuclease crystallized from aqueous ethanol. Comparison with crystals from salt solutions and with ribonuclease A from aqueous alcohol solutions.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		F8 H12 T45 C58 K66 C72 Y73 K104 H105 I106 I107 V108 A109 C110 E111
Binding residue
(residue number reindexed from 1)		F8 H12 T45 C58 K66 C72 Y73 K104 H105 I106 I107 V108 A109 C110 E111
Enzymatic activity
Catalytic site (original residue number in PDB) H12 K41
Catalytic site (residue number reindexed from 1) H12 K41
Enzyme Commision number 4.6.1.18: pancreatic ribonuclease.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0004519 endonuclease activity
GO:0004522 ribonuclease A activity
GO:0004540 RNA nuclease activity
GO:0005515 protein binding
GO:0016829 lyase activity
Biological Process
GO:0050830 defense response to Gram-positive bacterium
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1ssc, PDBe:1ssc, PDBj:1ssc
PDBsum1ssc
PubMed15299768
UniProtP61823|RNAS1_BOVIN Ribonuclease pancreatic (Gene Name=RNASE1)

[Back to BioLiP]