Structure of PDB 1skg Chain A Binding Site BS01

Receptor Information

>1skg Chain A (length=121) Species: 97228 (Daboia russelii pulchella)

SLLEFGKMILEETGKLAIPSYSSYGCYCGWGGKGTPKDATDRCCFVHDCC
YGNLPDCNPKSDRYKYKRVNGAIVCEKGTSCENRICECDKAAAICFRQNL
NTYSKKYMLYPDFLCKGELKC

Ligand information

>1skg Chain B (length=5)

VAFRS

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1skg Structure-based rational drug design: Crystal structure of the complex formed between Phospholipase A2 and a pentapeptide Val-Ala-Phe-Arg-Ser
• Resolution: 1.21 Å
• Binding residue (original residue number in PDB): L2002 F2005 I2019 G2030 W2031 G2032 H2048 D2049 Y2052 K2069
• Binding residue (residue number reindexed from 1): L2 F5 I18 G29 W30 G31 H47 D48 Y51 K60

Enzymatic activity

• Catalytic site (original residue number in PDB): Y2028 G2030 G2032 H2048 D2049 Y2052 Y2073 D2099
• Catalytic site (residue number reindexed from 1): Y27 G29 G31 H47 D48 Y51 Y64 D89
• Enzyme Commision number: 3.1.1.4: phospholipase A2.

Gene Ontology

Molecular Function

• GO:0004623 phospholipase A2 activity
• GO:0005509 calcium ion binding
• GO:0005543 phospholipid binding
• GO:0016787 hydrolase activity
• GO:0046872 metal ion binding
• GO:0047498 calcium-dependent phospholipase A2 activity
• GO:0090729 toxin activity

Biological Process

• GO:0006644 phospholipid metabolic process
• GO:0016042 lipid catabolic process
• GO:0035821 modulation of process of another organism
• GO:0042130 negative regulation of T cell proliferation
• GO:0050482 arachidonate secretion

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:1skg, PDBe:1skg, PDBj:1skg
• PDBsum: 1skg
• UniProt: P59071|PA2B8_DABRR Basic phospholipase A2 VRV-PL-VIIIa