Structure of PDB 1si3 Chain A Binding Site BS01

Receptor Information
>1si3 Chain A (length=120) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MAQPVIEFMCEVLDIRNIDEQPKPLTDSQRVRFTKEIKGLKVEVTHCGQM
KRKYRVCNVTRRPASHQTFPLQVECTVAQYFKQKYNLQLKYPHLPCLQVG
QEQKHTYLPLEVCNIVAGQR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1si3 Structural basis for overhang-specific small interfering RNA recognition by the PAZ domain.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		H269 M273 R275 R278 F292 Y309 F310 Y314 K333 H334 T335 Y336 G347 Q348
Binding residue
(residue number reindexed from 1)		H46 M50 R52 R55 F69 Y80 F81 Y85 K104 H105 T106 Y107 G118 Q119
Binding affinityPDBbind-CN: Kd=2.18nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1si3, PDBe:1si3, PDBj:1si3
PDBsum1si3
PubMed15152257
UniProtQ9UL18|AGO1_HUMAN Protein argonaute-1 (Gene Name=AGO1)

[Back to BioLiP]