Structure of PDB 1shc Chain A Binding Site BS01

Receptor Information
>1shc Chain A (length=195) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHMGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEV
LQSMRALDFNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGR
SNLKFAGMPITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDTAE
YVAYVAKDPVNQRACHILECPEGLAQDVISTIGQAFELRFKQYLR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1shc Structure and ligand recognition of the phosphotyrosine binding domain of Shc.
ResolutionN/A
Binding residue
(original residue number in PDB)		M66 R67 A68 I150 S151 F152 A153 S154 K169 I191 I194 G195 F198 F202 Y205
Binding residue
(residue number reindexed from 1)		M54 R55 A56 I138 S139 F140 A141 S142 K157 I179 I182 G183 F186 F190 Y193
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0035556 intracellular signal transduction

View graph for
Biological Process
External links
PDB RCSB:1shc, PDBe:1shc, PDBj:1shc
PDBsum1shc
PubMed8524391
UniProtP29353|SHC1_HUMAN SHC-transforming protein 1 (Gene Name=SHC1)

[Back to BioLiP]