Structure of PDB 1shb Chain A Binding Site BS01

Receptor Information
>1shb Chain A (length=103) Species: 11886 (Rous sarcoma virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AEEWYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNA
KGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYYSKHADGLCHRLTNV
CPT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1shb Crystal structure of the phosphotyrosine recognition domain SH2 of v-src complexed with tyrosine-phosphorylated peptides.
Resolution2.0 Å
Binding residue
(original residue number in PDB)
R12 R32 S34 E35 T36 H58 Y59 K60 T72 R74 G93
Binding residue
(residue number reindexed from 1)
R11 R31 S33 E34 T35 H57 Y58 K59 T71 R73 G92
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
External links
PDB RCSB:1shb, PDBe:1shb, PDBj:1shb
PDBsum1shb
PubMed1379696
UniProtP00524|SRC_RSVSA Tyrosine-protein kinase transforming protein Src (Gene Name=V-SRC)

[Back to BioLiP]