Structure of PDB 1sfu Chain A Binding Site BS01

Receptor Information
>1sfu Chain A (length=70) Species: 132475 (Yaba-like disease virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CTVNDAEIFSLVKKEVLSLNTNDYTTAISLSNRLKINKKKINQQLYKLQK
EDTVKMVPSNPPKWFKNYNC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1sfu A poxvirus protein forms a complex with left-handed Z-DNA: crystal structure of a Yatapoxvirus Zalpha bound to DNA.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		K44 N47 Q48 Y51 P67
Binding residue
(residue number reindexed from 1)		K39 N42 Q43 Y46 P62
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003726 double-stranded RNA adenosine deaminase activity

View graph for
Molecular Function
External links
PDB RCSB:1sfu, PDBe:1sfu, PDBj:1sfu
PDBsum1sfu
PubMed15448208
UniProtQ9DHS8|E3_YLDV Protein E3 homolog (Gene Name=34L)

[Back to BioLiP]