Structure of PDB 1sb0 Chain A Binding Site BS01

Receptor Information
>1sb0 Chain A (length=87) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GVRKGWHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKV
EGDMYESANSRDEYYHLLAEKIYKIQKELEEKRRSRL
Ligand information
>1sb0 Chain B (length=25) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KEKRIKELELLLMSTENELKGQQAL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1sb0 Solution Structure of the KIX Domain of CBP Bound to the Transactivation Domain of c-Myb
ResolutionN/A
Binding residue
(original residue number in PDB)		H17 L18 K21 R61 Y65 I72 Y73 Q76 E80
Binding residue
(residue number reindexed from 1)		H17 L18 K21 R61 Y65 I72 Y73 Q76 E80
Enzymatic activity
Enzyme Commision number 2.3.1.-
2.3.1.48: histone acetyltransferase.
Gene Ontology
Molecular Function
GO:0003712 transcription coregulator activity
GO:0004402 histone acetyltransferase activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1sb0, PDBe:1sb0, PDBj:1sb0
PDBsum1sb0
PubMed15019774
UniProtP45481|CBP_MOUSE Histone lysine acetyltransferase CREBBP (Gene Name=Crebbp)

[Back to BioLiP]