Structure of PDB 1sax Chain A Binding Site BS01

Receptor Information
>1sax Chain A (length=120) Species: 158879 (Staphylococcus aureus subsp. aureus N315) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NKTYEISSAEWEVMNIIWMKKYASANNIIEEIQMQKDWSPKTIRTLITRL
YKKGFIDRKKDNKIFQYYSLVEESDIKYKTSKNFINKVYKGGFNSLVLNF
VEKEDLSQDEIEELRNILNK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1sax On the transcriptional regulation of methicillin resistance: MecI repressor in complex with its operator
Resolution2.8 Å
Binding residue
(original residue number in PDB)		R46 R60 I66 F67
Binding residue
(residue number reindexed from 1)		R44 R58 I64 F65
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0045892 negative regulation of DNA-templated transcription
GO:0046677 response to antibiotic
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1sax, PDBe:1sax, PDBj:1sax
PDBsum1sax
PubMed14960592
UniProtP68261|MECI_STAAN Methicillin resistance regulatory protein MecI (Gene Name=mecI)

[Back to BioLiP]