Structure of PDB 1s7t Chain A Binding Site BS01

Receptor Information
>1s7t Chain A (length=276) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRAR
WMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISG
CEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQA
GEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVT
LRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVP
LGKEQYYTCHVYHQGLPEPLTLRWEP
Ligand information
>1s7t Chain C (length=8) Species: 11627 (Lymphocytic choriomeningitis virus (strain WE)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AVFNFATM
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1s7t Determination of structural principles underlying three different modes of lymphocytic choriomeningitis virus escape from CTL recognition.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		Y7 E63 K66 N70 S73 F74 D77 Y84 Q114 Y116 K146 E152 R155 L156 Y159 Y171
Binding residue
(residue number reindexed from 1)		Y7 E63 K66 N70 S73 F74 D77 Y84 Q114 Y116 K146 E152 R155 L156 Y159 Y171
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0042605 peptide antigen binding
Biological Process
GO:0001913 T cell mediated cytotoxicity
GO:0001916 positive regulation of T cell mediated cytotoxicity
GO:0002474 antigen processing and presentation of peptide antigen via MHC class I
GO:0002485 antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-dependent
GO:0006955 immune response
GO:0010977 negative regulation of neuron projection development
GO:0019882 antigen processing and presentation
GO:0042590 antigen processing and presentation of exogenous peptide antigen via MHC class I
GO:0042742 defense response to bacterium
GO:0048839 inner ear development
Cellular Component
GO:0009897 external side of plasma membrane
GO:0016020 membrane
GO:0030670 phagocytic vesicle membrane
GO:0042612 MHC class I protein complex
GO:0098553 lumenal side of endoplasmic reticulum membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1s7t, PDBe:1s7t, PDBj:1s7t
PDBsum1s7t
PubMed15100292
UniProtP01901|HA1B_MOUSE H-2 class I histocompatibility antigen, K-B alpha chain (Gene Name=H2-K1)

[Back to BioLiP]