Structure of PDB 1s6m Chain A Binding Site BS01

Receptor Information
>1s6m Chain A (length=288) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLSHMVLTRQDIGRAASYYEDGADDYDASEWQGKGAEELGLSGEVDSKRF
RELLAGNIGEGHRIMRSATRQDSKERIGLDLTFSAPKSVSLQALVAGDAE
IIKAHDRAVARTLEQAEARAQARQKIQGKTRIETTGNLVIGKFRHETSRE
RDPQLHTHAVILNMTKRSDGQWRALKNDEIVKATRYLGAVYNAELAHELQ
KLGYQLRYGKDGNFDLAHIDRQQIEGFSKRTEQIAEWYAARGLDPNSVSL
EQKQAAKVLSRAKKTSVDREALRAEWQATAKELGIDFS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1s6m Unveiling the molecular mechanism of a conjugative relaxase: The structure of TrwC complexed with a 27-mer DNA comprising the recognition hairpin and the cleavage site.
Resolution2.28 Å
Binding residue
(original residue number in PDB)		M1 H4 M5 R14 A73 R75 Q76 K79 R81 S89 A90 K92 R128 Q129 K130 Q132 Q159 R172 R178 A179 N182 D183 R226 S233 R235 T236 K258 K262
Binding residue
(residue number reindexed from 1)		M1 H4 M5 R14 A68 R70 Q71 K74 R76 S84 A85 K87 R123 Q124 K125 Q127 Q154 R167 R173 A174 N177 D178 R221 S228 R230 T231 K253 K257
Enzymatic activity
Enzyme Commision number ?
External links