Structure of PDB 1s40 Chain A Binding Site BS01

Receptor Information
>1s40 Chain A (length=187) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KMARKDPTIEFCQLGLDTFETKYITMFGMLVSCSFDKPAFISFVFSDFTK
NDIVQNYLYDRYLIDYENKLELNEGFKAIMYKNQFETFDSKLRKIFNNGL
RDLQNGRDENLSQYGIVCKMNIKVKMYNGKLNAIVRECEPVPHSQISSIA
SPSQCEHLRLFYQRAFKRIGESAISRYFEEYRRFFPI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1s40 Structural basis for telomeric single-stranded DNA recognition by yeast Cdc13
ResolutionN/A
Binding residue
(original residue number in PDB)		T25 Y27 S38 K41 A43 F44 S46 Y61 L62 Y63 D64 Y66 Y70 K73 K81 I83 Y85 D112 N114 K127 K129 Y131 L135 N136 I138
Binding residue
(residue number reindexed from 1)		T21 Y23 S34 K37 A39 F40 S42 Y57 L58 Y59 D60 Y62 Y66 K69 K77 I79 Y81 D108 N110 K123 K125 Y127 L131 N132 I134
Binding affinityPDBbind-CN: Kd=0.3nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000723 telomere maintenance
Cellular Component
GO:0000781 chromosome, telomeric region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1s40, PDBe:1s40, PDBj:1s40
PDBsum1s40
PubMed15066429
UniProtP32797|CDC13_YEAST Cell division control protein 13 (Gene Name=CDC13)

[Back to BioLiP]