Structure of PDB 1s32 Chain A Binding Site BS01

Receptor Information
>1s32 Chain A (length=98) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Ligand information
>1s32 Chain I (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagcggaattccgctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1s32 Molecular Recognition of the Nucleosomal 'Supergroove'
Resolution2.05 Å
Binding residue
(original residue number in PDB)		R440 Y441 R442 T445 R463 R472 R483 F484 Q485 S486 R516 V517 T518
Binding residue
(residue number reindexed from 1)		R3 Y4 R5 T8 R26 R35 R46 F47 Q48 S49 R79 V80 T81
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1s32, PDBe:1s32, PDBj:1s32
PDBsum1s32
PubMed15100411
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]