Structure of PDB 1rzx Chain A Binding Site BS01

Receptor Information
>1rzx Chain A (length=98) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ETHRRVRLLKHGSDKPLGFYIRDGTSVRVTASGLEKQPGIFISRLVPGGL
AESTGLLAVNDEVIEVNGIEVAGKTLDQVTDMMVANSSNLIITVKPAN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1rzx Cdc42 regulates the Par-6 PDZ domain through an allosteric CRIB-PDZ transition.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		P171 L172 F174 Y175 I176 R177 S198 R199 T235
Binding residue
(residue number reindexed from 1)		P16 L17 F19 Y20 I21 R22 S43 R44 T80
Enzymatic activity
Enzyme Commision number ?
External links