Structure of PDB 1rz9 Chain A Binding Site BS01

Receptor Information
>1rz9 Chain A (length=193) Species: 82300 (adeno-associated virus 5) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MATFYEVIVRVPFDVEEHLPGISDSFVDWVTGQIWELPPESDLNLTLVEQ
PQLTVADRIRRVFLYEWNKFSKQESKFFVQFEKGSEYFHLHTLVETSGIS
SMVLGRYVSQIRAQLVKVVFQGIEPQINDWVAITKVKKGGANKVVDSGYI
PAYLLPKVQPELQWAWTNLDEYKLAALNLEERKRLVAQFLAES
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1rz9 The nuclease domain of adeno-associated virus rep coordinates replication initiation using two distinct DNA recognition interfaces.
Resolution3.1 Å
Binding residue
(original residue number in PDB)
M102 V103 R106 K138
Binding residue
(residue number reindexed from 1)
M102 V103 R106 K138
Enzymatic activity
Enzyme Commision number ?
External links