Structure of PDB 1rxm Chain A Binding Site BS01

Receptor Information
>1rxm Chain A (length=245) Species: 2234 (Archaeoglobus fulgidus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MIDVIMTGELLKTVTRAIVALVSEARIHFLEKGLHSRAVDPANVAMVIVD
IPKDSFEVYNIDEEKTIGVDMDRIFDISKSISTKDLVELIVEDESTLKVK
FGSVEYKVALIDPSAIRKEPRIPELELPAKIVMDAGEFKKAIAAADKISD
QVIFRSDKEGFRIEAKGDVDSIVFHMTETELIEFNGGEARSMFSVDYLKE
FCKVAGSGDLLTIHLGTNYPVRLVFELVGGRAKVEYILAPRIESE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1rxm Structural Basis for FEN-1 Substrate Specificity and PCNA-Mediated Activation in DNA Replication and Repair
Resolution2.8 Å
Binding residue
(original residue number in PDB)		N43 V44 M46 P123 L125 Y219 P220 A239 P240 R241 I242 E243 S244 E245
Binding residue
(residue number reindexed from 1)		N43 V44 M46 P123 L125 Y219 P220 A239 P240 R241 I242 E243 S244 E245
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030337 DNA polymerase processivity factor activity
Biological Process
GO:0006260 DNA replication
GO:0006272 leading strand elongation
GO:0006275 regulation of DNA replication

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1rxm, PDBe:1rxm, PDBj:1rxm
PDBsum1rxm
PubMed14718165
UniProtO29912|PCNA_ARCFU DNA polymerase sliding clamp (Gene Name=pcn)

[Back to BioLiP]