Structure of PDB 1rqq Chain A Binding Site BS01

Receptor Information

>1rqq Chain A (length=297) Species: 9606 (Homo sapiens)

DEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESA
SLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKS
YLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAAR
NCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVF
TTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPE
RVTDLMRMCWQFNPNMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENK

Ligand information

>1rqq Chain E (length=14)

LPATGDFMNMSPVG

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1rqq Structural basis for recruitment of the adaptor protein APS to the activated insulin receptor.
• Resolution: 2.6 Å
• Binding residue (original residue number in PDB): R1136 K1165 G1167 K1168 G1169 L1170 L1171 V1173 W1175 L1181 K1182 D1183 N1215 M1223
• Binding residue (residue number reindexed from 1): R150 K179 G181 K182 G183 L184 L185 V187 W189 L195 K196 D197 N229 M237

Enzymatic activity

• Catalytic site (original residue number in PDB): D1132 A1134 R1136 N1137 D1150 E1159 L1171
• Catalytic site (residue number reindexed from 1): D146 A148 R150 N151 D164 E173 L185
• Enzyme Commision number: 2.7.10.1: receptor protein-tyrosine kinase.

Gene Ontology

Molecular Function

• GO:0004672 protein kinase activity
• GO:0004713 protein tyrosine kinase activity
• GO:0004714 transmembrane receptor protein tyrosine kinase activity
• GO:0005524 ATP binding

Biological Process

• GO:0006468 protein phosphorylation
• GO:0007169 cell surface receptor protein tyrosine kinase signaling pathway

Cellular Component

• GO:0016020 membrane

External links

• PDB: RCSB:1rqq, PDBe:1rqq, PDBj:1rqq
• PDBsum: 1rqq
• PubMed: 14690593
• UniProt: P06213|INSR_HUMAN Insulin receptor (Gene Name=INSR)