Structure of PDB 1rpu Chain A Binding Site BS01

Receptor Information
>1rpu Chain A (length=138) Species: 39443 (Carnation Italian ringspot virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DTREQANGERWDGGSGGITSPFKLPDESPSWTEWRLYNDENPLGFKESWG
FGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFLGANQVGCTYSI
RFRGVSVTISGGSRTLQHLCEMAIRSKQELLQLTPVEV
Ligand information
>1rpu Chain C (length=21) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cguacgcgucacgcguacguu
.....................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1rpu Size selective recognition of siRNA by an RNA silencing suppressor
Resolution2.5 Å
Binding residue
(original residue number in PDB)		R11 W39 T40 R43 K67 S113 R115 S120
Binding residue
(residue number reindexed from 1)		R3 W31 T32 R35 K53 S99 R101 S106
Binding affinityPDBbind-CN: Kd=0.17nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0019049 virus-mediated perturbation of host defense response
GO:0052170 symbiont-mediated suppression of host innate immune response
Cellular Component
GO:0044423 virion component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1rpu, PDBe:1rpu, PDBj:1rpu
PDBsum1rpu
PubMed14697199
UniProtQ66104|P19_CIRV RNA silencing suppressor p19 (Gene Name=ORF4)

[Back to BioLiP]